DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CLIPB12

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_319994.4 Gene:CLIPB12 / 1280175 VectorBaseID:AGAP009217 Length:341 Species:Anopheles gambiae


Alignment Length:218 Identity:42/218 - (19%)
Similarity:84/218 - (38%) Gaps:29/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVIT------NVKEIVMHEGYYSG 128
            :.|.|::.::..::|.|.|:|   :.....|..........|..|      .::..:.|:.....
Mosquito   133 YHCAGTLISKRYVLTTAFCII---SKNLAFVQLRKKDCDERGACTLKPQDIPIERTIGHDSSNKP 194

  Fly   129 AAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYS---SNQLLAVDV 190
            ..:|| |.::.:......|: .::.|.|.:....:.|.:|.  :..|....|:   ::.:...:|
Mosquito   195 WLFNN-IGLVRLARDASFNS-DVRPICLPMGPEYQTTDTKY--FIVTRKEDYALLDTDAVAISEV 255

  Fly   191 PIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAV-----RDELYGVVSW 250
            .:|:||.|    :.:...|  :.::.:||.:  :...|.|....|..|..     |..:||..::
Mosquito   256 HLVANEYC----QSWLQRT--VHNSQMCAIE--LAPNDDCAKPYGASLTAQARNGRHVMYGAHAF 312

  Fly   251 GNSCALPNYPGVYANVAYLRPWI 273
            |......|...||..|.....||
Mosquito   313 GMDICTQNESTVYTRVESFVDWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 40/216 (19%)
Tryp_SPc 39..276 CDD:238113 42/218 (19%)
CLIPB12XP_319994.4 Tryp_SPc 118..338 CDD:304450 42/218 (19%)
Tryp_SPc 118..335 CDD:214473 40/216 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.