DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CLIPD7

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_319747.4 Gene:CLIPD7 / 1279958 VectorBaseID:AGAP008998 Length:413 Species:Anopheles gambiae


Alignment Length:279 Identity:78/279 - (27%)
Similarity:123/279 - (44%) Gaps:39/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PLLEDLDEKSVP-------DGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETT 81
            |||...:|..:|       ..||:||...:.|:.|:|..:|..         .::|||.:.:...
Mosquito   147 PLLHPQNECGIPQTSQNTLQKRIIGGRTANFAEYPWQAHIRIA---------EYQCGGVLVSRRF 202

  Fly    82 IVTAAHCVIGTVASQYKVVAGTNFQTGSDGVIT--------NVKEIVMHEGYYSGAAYNN--DIA 136
            :.|||||:.........:..| ...|.:.|.|.        .|:..::|..:.......:  |:|
Mosquito   203 VATAAHCIQQARLKDILIYLG-ELDTQNSGKIVEPLPAEKHRVEMKIVHPKFIFRMTQPDRYDLA 266

  Fly   137 ILFVDPPLPLNNFTIKAIKLALEQPIE--GTVSKVSGWGTTSP--GGYSSNQLLAVDVPIVSNEL 197
            :|.:..|....:. |..|.|.: :|:|  |....::|||.|:.  |...:|.|....|||:|.:.
Mosquito   267 LLKLTRPAGYKSH-ILPICLPM-RPLELVGRKGIIAGWGKTNANMGQTGTNILRTAAVPIISTKE 329

  Fly   198 CDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE----LYGVVSWGNSCALPN 258
            |.: :....:....:.:.|.||| ...|..|||.|||||||.:.|.    |.|:.|.|..|.:.:
Mosquito   330 CLR-WHSSKNINVELFNEMFCAG-HSDGHQDACLGDSGGPLIINDRGRYTLIGITSAGFGCGVDH 392

  Fly   259 YPGVYANVAYLRPWIDAVL 277
            .||:|.||.....||.:|:
Mosquito   393 QPGIYHNVQKTIKWIQSVI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 70/252 (28%)
Tryp_SPc 39..276 CDD:238113 71/254 (28%)
CLIPD7XP_319747.4 Tryp_SPc 168..407 CDD:214473 70/252 (28%)
Tryp_SPc 169..410 CDD:238113 71/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.