DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG43335

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:301 Identity:77/301 - (25%)
Similarity:133/301 - (44%) Gaps:61/301 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AFLVSLVALTQGL------PLLE-DLDEKSVPD---GRIVGGYATDIAQVPYQISLRYKGITTPE 65
            |||| ::::.|.|      .||| :...:::|.   .||:||...:|...|:...|        .
  Fly     5 AFLV-IISVCQWLCRFGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYL--------Y 60

  Fly    66 NPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVIT-------NVKEIVMHE 123
            |.|.:.|.|::.....::|||||:  ..:....|..|.:..|.|||.:.       :|...:.|:
  Fly    61 NEFHYFCAGTLITNQFVLTAAHCI--EASKNLTVRLGGSGLTRSDGSMCQITAEDYSVSMAIKHK 123

  Fly   124 GYYSGAAYNNDIAIL-------FVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYS 181
             |::.:...||||::       |.|...|:......|::|.||   :|.....:|||......: 
  Fly   124 -YFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLE---DGMTLMATGWGLADKRMH- 183

  Fly   182 SNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLA------- 239
            .:.|....:.:::..:|.:.|:      ..||...:|||.:   ..:.|.|||||||.       
  Fly   184 PHLLQEAPITVMNRNVCSKLYD------VAITQGQICAGDK---ETNTCLGDSGGPLGGVVNYYG 239

  Fly   240 -VRDELYGVVSWGN-SCALPNYPGVYANVAYLRPWIDAVLA 278
             :|...||:.|:|: .|   ..|.:|.:::....||:.|::
  Fly   240 DLRFVQYGITSFGDIEC---RSPSIYTDLSTYSGWINMVVS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 64/257 (25%)
Tryp_SPc 39..276 CDD:238113 65/259 (25%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 64/257 (25%)
Tryp_SPc 42..275 CDD:238113 65/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.