DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP011477

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_317829.4 Gene:AgaP_AGAP011477 / 1278364 VectorBaseID:AGAP011477 Length:276 Species:Anopheles gambiae


Alignment Length:240 Identity:96/240 - (40%)
Similarity:129/240 - (53%) Gaps:34/240 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCV--IGTVASQYKVV 100
            |:|||..|.|...|||:|||        ...:|.|||:|.|..||:||||||  ...|.|.::|.
Mosquito    51 RVVGGSDTTIEAHPYQVSLR--------RLHKHSCGGAILNTNTILTAAHCVDYPELVPSDFEVR 107

  Fly   101 AGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNN-----DIAILFVDPPLPLNNFTIKAIKL---A 157
            ||:.|:.....:|| |.:|..|      .:||:     ||::|.:...|.|:. |::.|.|   .
Mosquito   108 AGSTFRNEGGQLIT-VAQIHTH------PSYNDWTLEWDISVLKLVSSLQLSP-TVQPISLPDRG 164

  Fly   158 LEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKR 222
            |..| :||...::|||:....|.|:|.|..|.:|||||..|...|::|..    |....:|||.:
Mosquito   165 LTIP-DGTSVSLAGWGSLYYQGPSTNHLQHVMLPIVSNSRCGMAYKNFAP----ILPFHICAGHK 224

  Fly   223 GVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVA 267
               |.|||||||||||..:..:.|:||||..||..|||.||..|:
Mosquito   225 ---GKDACQGDSGGPLVYQSRVVGIVSWGYGCAFENYPSVYTRVS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 96/240 (40%)
Tryp_SPc 39..276 CDD:238113 95/239 (40%)
AgaP_AGAP011477XP_317829.4 Tryp_SPc 51..272 CDD:214473 96/240 (40%)
Tryp_SPc 52..272 CDD:238113 95/239 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.