DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP006385

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_316419.4 Gene:AgaP_AGAP006385 / 1276997 VectorBaseID:AGAP006385 Length:260 Species:Anopheles gambiae


Alignment Length:280 Identity:75/280 - (26%)
Similarity:126/280 - (45%) Gaps:46/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGLLAFLVSLVALTQGLPLLEDLDEKSVPDG--RIVGGYATDIAQVPYQISLR-YKGITTPENPF 68
            :.|||.:.|:.              ::.|.|  |:|.|....:.|.|||:.|. :.|     |..
Mosquito     8 LALLALVASVA--------------QAAPRGGMRVVNGETAKLGQFPYQVRLTLHVG-----NGQ 53

  Fly    69 RHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGT---NFQTGSDGVITNVKEIVMHEGYYSGAA 130
            :..||||:.||..::||.|||:  :|...:|..|.   :..|....::....|...|| .|:...
Mosquito    54 QALCGGSLLNEEWVLTAGHCVM--LAKSVEVHLGAVDFSDNTNDGRLVLESTEFFKHE-KYNPLF 115

  Fly   131 YNNDIAILFVDPPLPLNNFTIKAIKLAL-EQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVS 194
            ..||:|::.:...:..:. .::.::|.. ::...|....|||||....||..:.:|....:.::.
Mosquito   116 VANDVALVKLPSKVEFSE-RVQPVRLPTGDEDFAGREVVVSGWGLMVNGGQVAQELQYATLKVIP 179

  Fly   195 NELCDQDYEDFGDETYRITSAMLCAGKRGVGG--ADACQGDSGGPLAVRDE--LYGVVSWGNS-- 253
            |:.|.:.:...     .:..:.|||    ||.  ...|.|||||||.:.::  |.||||:|::  
Mosquito   180 NKQCQKTFSPL-----LVRKSTLCA----VGEELRSPCNGDSGGPLVLAEDKTLVGVVSFGHAQG 235

  Fly   254 CALPNYPGVYANVAYLRPWI 273
            |. ..:|..:|.|...|.|:
Mosquito   236 CD-KGHPAAFARVTAFRDWV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 68/245 (28%)
Tryp_SPc 39..276 CDD:238113 68/246 (28%)
AgaP_AGAP006385XP_316419.4 Tryp_SPc 27..254 CDD:214473 68/245 (28%)
Tryp_SPc 28..257 CDD:238113 68/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.