DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP005791

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_315804.4 Gene:AgaP_AGAP005791 / 1276457 VectorBaseID:AGAP005791 Length:248 Species:Anopheles gambiae


Alignment Length:251 Identity:53/251 - (21%)
Similarity:101/251 - (40%) Gaps:34/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVA 101
            |:.:||....|||.|:...:..:..|...|       |:|.:...::|:|..|..|..|.|.:. 
Mosquito    18 GQQIGGTDVSIAQYPFVAGILLQRSTIIGN-------GAILSPNWVLTSASAVYSTPDSDYSIA- 74

  Fly   102 GTNFQTGSDGVIT-----NVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQP 161
                 |||:.::|     .|:.|..|..:. |..||  :|::.|...:...: |:::|.:|...|
Mosquito    75 -----TGSEELLTPAAQYQVQRIFRHPEFV-GWDYN--VALVKVSGKIAFGD-TVQSIAIATTDP 130

  Fly   162 IEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVS-NELCDQDYEDFGDETYRITSAMLCAGKRGVG 225
            .....:.:..:|....|   ::.|.:....::| |:.|....:::..:.........|.    :.
Mosquito   131 ETVNDATMLSYGKNEDG---TSHLRSATYTLISDNDDCVPLLQEYQAKEVIWQHHGFCL----IP 188

  Fly   226 GADACQG----DSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAYLRPWIDAVL 277
            .....||    |:|.||....:||.|.::..:....|...|...:.....||.:::
Mosquito   189 PPGTQQGQWYNDAGAPLVADGQLYAVFAFAENEGGTNEGSVATRLTSFAGWIQSIM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 50/244 (20%)
Tryp_SPc 39..276 CDD:238113 52/246 (21%)
AgaP_AGAP005791XP_315804.4 Tryp_SPc 21..243 CDD:304450 52/245 (21%)
Tryp_SPc 21..240 CDD:214473 50/242 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.