DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP005707

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_315716.4 Gene:AgaP_AGAP005707 / 1276376 VectorBaseID:AGAP005707 Length:299 Species:Anopheles gambiae


Alignment Length:279 Identity:76/279 - (27%)
Similarity:116/279 - (41%) Gaps:53/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSSWIVGLLAFLVSLVALTQGL-PLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPE 65
            |..|.|.........:...||| ||.:|    .|...||..|......|.|:.:.:...|  :..
Mosquito    28 SVDWSVVRTLHQTDAIRAKQGLAPLTDD----QVRSSRISDGQIATATQFPWAVGVLISG--SSS 86

  Fly    66 NPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAA 130
            :.|   |.|.:.:...::|||.|:.|  ::...::.|.:..|..:..| .|..|:.|..|.|  .
Mosquito    87 HSF---CSGVLISPRFVLTAAVCISG--SNTLTILLGASDMTRVEEFI-GVSNILSHPNYSS--F 143

  Fly   131 YN-NDIAILFVDPPLPLNNFTIKAIKLA----LEQPIEGTVSKVSGWGTTSPGGYSSNQLL---- 186
            :| :|||||.:..|.|:.| ||:.|.|.    :........:..:|||.|   |...|:.:    
Mosquito   144 FNRDDIAILTLSSPAPIRN-TIRPIDLPRWSDVGNNFNNWAATTAGWGNT---GRRENEPIPIPN 204

  Fly   187 ---AVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAV----RDEL 244
               ||| .:.||.:|...: .|..:|:..||.       ..||  .|.||.|||:.|    |..|
Mosquito   205 LHFAVD-SVNSNFVCGLSH-TFIRDTHICTST-------DNGG--PCNGDEGGPVTVTESGRTFL 258

  Fly   245 YGVVSWGNSCALPNYPGVY 263
            .|:.|:       :|.|::
Mosquito   259 VGIHSF-------HYSGLF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 66/242 (27%)
Tryp_SPc 39..276 CDD:238113 65/241 (27%)
AgaP_AGAP005707XP_315716.4 Tryp_SPc 61..290 CDD:214473 66/242 (27%)
Tryp_SPc 62..293 CDD:238113 65/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.