DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP004858

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_314333.4 Gene:AgaP_AGAP004858 / 1275108 VectorBaseID:AGAP004858 Length:435 Species:Anopheles gambiae


Alignment Length:219 Identity:57/219 - (26%)
Similarity:89/219 - (40%) Gaps:24/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CGGSIFNETTIVTAAHCVIGT--VASQ------YKVVAGTNFQTGSDGVITNVKEIVMHEGYYSG 128
            ||||:.....::|||||.:..  ||.|      ..:.||.............:.....|..:...
Mosquito    17 CGGSLITPRHVLTAAHCALNDDGVAPQVVRLGVIDITAGLYDPQNQFAQEYGISSFRRHPEHEFR 81

  Fly   129 AAYNNDIAILFVDPPLPLNNFTIKA-IKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPI 192
            |.| :||.::.:|.|:.|.:..:.| :....:.|:...  :..|:|.||.||..:..||.|.:..
Mosquito    82 AEY-HDIGLVTLDRPVTLTDAVVPACLWTGAQVPLRRL--EAVGFGQTSFGGERTPILLKVQLSP 143

  Fly   193 VSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVR--------DELYGVVS 249
            |.|..|.:.|.........:....:||....:   |.|.|||||||.::        ..:.|:.|
Mosquito   144 VDNSACGRFYPPSRRRRQGLIDQQMCASDERM---DTCHGDSGGPLQLKLMANNRLIPFVVGITS 205

  Fly   250 WGNSCALPNYPGVYANVAYLRPWI 273
            :|..|.... |.||..|:....|:
Mosquito   206 FGRFCGTAT-PAVYTRVSSYVDWL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 56/217 (26%)
Tryp_SPc 39..276 CDD:238113 57/219 (26%)
AgaP_AGAP004858XP_314333.4 Tryp_SPc 1..229 CDD:238113 57/219 (26%)
Tryp_SPc 1..227 CDD:214473 56/216 (26%)
Tryp_SPc 295..>384 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.