DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP004568

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_313873.5 Gene:AgaP_AGAP004568 / 1274710 VectorBaseID:AGAP004568 Length:283 Species:Anopheles gambiae


Alignment Length:261 Identity:89/261 - (34%)
Similarity:129/261 - (49%) Gaps:49/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYK-- 98
            :.:||||:..:|.:.|:.::|.|..        |..||||:.|:..::||||||.|:..|::.  
Mosquito    40 NSKIVGGHEAEIGRYPWMVALYYNN--------RFICGGSLINDRYVLTAAHCVFGSDRSRFSVK 96

  Fly    99 -------VVAGTNFQTGSDGVITN--VKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAI 154
                   |....:|:.....::||  :..:|.         ..||:|:|.:..|:||.. ||..:
Mosquito    97 FLMHDRTVPKEDSFERKVSYIMTNWFLNVLVF---------ITNDVALLKLSEPVPLGE-TIIPV 151

  Fly   155 KLALEQPIEGTV-----SKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITS 214
            .|    |.||..     ..|:|||....|.:.. :|..|.|||:|||.|....:.|   .::|..
Mosquito   152 CL----PPEGNTYAGQEGIVTGWGKLGDGTFPM-KLQEVHVPILSNEQCHNQTQYF---RFQIND 208

  Fly   215 AMLCAGKRGVGGADACQGDSGGPLAVRDE------LYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            .|:||| ...||.|:||||||||:.|.|.      :.||||||..||.|.:||:||.|.....||
Mosquito   209 RMMCAG-IPEGGKDSCQGDSGGPMHVFDTEANRFVIAGVVSWGFGCAQPRFPGIYARVNRFISWI 272

  Fly   274 D 274
            :
Mosquito   273 N 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 87/256 (34%)
Tryp_SPc 39..276 CDD:238113 89/258 (34%)
AgaP_AGAP004568XP_313873.5 Tryp_SPc 42..272 CDD:214473 87/256 (34%)
Tryp_SPc 43..275 CDD:238113 89/258 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.