DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CLIPB5

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_313032.4 Gene:CLIPB5 / 1273975 VectorBaseID:AGAP004148 Length:379 Species:Anopheles gambiae


Alignment Length:300 Identity:95/300 - (31%)
Similarity:139/300 - (46%) Gaps:47/300 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SLVA-LTQGLPLLEDLDEKSV-PDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIF 77
            |||| :..|:.||....:..: ...||.||..|.|.:.|:...|:|   ..|.|.|...|||.:.
Mosquito    90 SLVAPVRVGVGLLPSPGQCGIQTSDRIFGGVNTRIDEFPWIALLKY---AKPNNVFGFHCGGVLI 151

  Fly    78 NETTIVTAAHCVIG------------------TVASQYKVVAGTNFQTGSDGVITNVKEIVMHEG 124
            |:..::||:|||.|                  |..:|.....|.:.......:...::..:.|..
Mosquito   152 NDRYVLTASHCVNGKDIPSTWNLAEVRLGEWDTSTAQDCEGLGDDVDCSPPPIDVPIEGKIPHPE 216

  Fly   125 YY-SGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIE-----GTVSKVSGWGTTSPGGYSS- 182
            |. :.|...||||:|.:...:|.::| ||.|.|.::..::     |...:|:|||.|:...:|: 
Mosquito   217 YVPTSAEQYNDIALLRLQQSVPYSDF-IKPICLPMQAELKARDYVGFRMQVAGWGRTATARFSNV 280

  Fly   183 NQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPL-AVRDE--- 243
            .|.:|||.  ||.:.|:|.|:   .|...:..:.||||  |..|.|:||||||||| .|...   
Mosquito   281 KQKVAVDG--VSLDACNQVYQ---REQVLLRQSQLCAG--GEAGKDSCQGDSGGPLTGVHTAGGL 338

  Fly   244 ----LYGVVSWG-NSCALPNYPGVYANVAYLRPWIDAVLA 278
                |.|:||:| ..|....:||||..|.....||.|.:|
Mosquito   339 QYWYLIGLVSFGPTPCGQAGWPGVYTKVDQYVDWITATIA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 84/268 (31%)
Tryp_SPc 39..276 CDD:238113 85/270 (31%)
CLIPB5XP_313032.4 CLIP 33..87 CDD:288855
Tryp_SPc 115..373 CDD:214473 84/268 (31%)
Tryp_SPc 116..373 CDD:238113 83/267 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.