DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP002432

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_312513.5 Gene:AgaP_AGAP002432 / 1273529 VectorBaseID:AGAP002432 Length:318 Species:Anopheles gambiae


Alignment Length:320 Identity:92/320 - (28%)
Similarity:137/320 - (42%) Gaps:68/320 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVGLLAFLVSLVAL------------TQGLPLLEDLDE---------------KSVPDGRIVGGY 43
            :|||||.|..:..|            :|..| :|:.|.               ::.|:.|||.|.
Mosquito     9 VVGLLALLHGVSPLPTISSSSYGIDWSQVRP-IEEFDHIKAHLPINLRTPIATQNAPNRRIVNGQ 72

  Fly    44 ATDIAQVPYQISLRYK---GITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNF 105
            .....|.|||::|..:   |:..        ||.||..:..::||||||...|.:...|..||..
Mosquito    73 EARPGQFPYQVALLGQFNAGVGL--------CGASIITQRYVLTAAHCVYTGVDASAPVANGTAI 129

  Fly   106 QTGSDGVITNVKE---------IVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALE-- 159
            ....:.:|....:         ::.|.| |......||||::.:| .|.:....|:.|:|...  
Mosquito   130 LGAHNRMIEEPSQQRITFSSSGVIGHPG-YDLFDVRNDIAVVRLD-ELIVYTDRIQPIRLPSRSD 192

  Fly   160 -QPIEGTVSKVSGWG---TTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAG 220
             :...|.:..|||:|   |.:|.  .|:.|..|..|:::|..|...:...   .:.|.:..:|  
Mosquito   193 TRTFAGLMGTVSGYGIYSTANPA--LSDVLNYVLNPVMTNADCRAGWSGL---EWLIEAQNIC-- 250

  Fly   221 KRGVGGADACQGDSGGPLAVRDE----LYGVVSWGNSCALPN-YPGVYANVAYLRPWIDA 275
            :.|.||..||..||||||.|:|.    ..||||:|:|....| .|.|:|.|.|...||:|
Mosquito   251 QSGDGGRAACNSDSGGPLTVQDSGESLQVGVVSFGSSVGCDNGVPTVFARVTYYLEWIEA 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 77/257 (30%)
Tryp_SPc 39..276 CDD:238113 79/260 (30%)
AgaP_AGAP002432XP_312513.5 Tryp_SPc 67..308 CDD:214473 77/257 (30%)
Tryp_SPc 68..311 CDD:238113 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.