DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP010661

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_311381.4 Gene:AgaP_AGAP010661 / 1272469 VectorBaseID:AGAP010661 Length:175 Species:Anopheles gambiae


Alignment Length:172 Identity:46/172 - (26%)
Similarity:75/172 - (43%) Gaps:24/172 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 GTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLP-LNNFTIKAIKLALEQPIEGT 165
            |:..|| ..|||....:||:|. ||:...::.|.||:.:..... .:|....|::.| |.|.: |
Mosquito     6 GSTTQT-RGGVIFQASKIVIHP-YYNPETHDYDAAIVEIKTSFQGYDNIAPIALQDA-EVPSD-T 66

  Fly   166 VSKVSGWG------TTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGV 224
            ....:|||      .|:|     :.|....:.:::.:.|...:..:.      |..::||.:...
Mosquito    67 TCYAAGWGLNNYDRRTTP-----DNLQYATLQVITQQQCSAAWGSYA------TPQVICAQQNNN 120

  Fly   225 GGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANV 266
            |  |.|:||||||.....:|.|..|:|........|..:|.|
Mosquito   121 G--DVCKGDSGGPFVCNGKLTGATSYGGIGCRGRLPSAFAKV 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 46/172 (27%)
Tryp_SPc 39..276 CDD:238113 46/172 (27%)
AgaP_AGAP010661XP_311381.4 Tryp_SPc <1..172 CDD:238113 46/172 (27%)
Tryp_SPc <1..162 CDD:214473 46/172 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.