DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CTR1_ANOGA

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_309033.2 Gene:CTR1_ANOGA / 1270348 VectorBaseID:AGAP006709 Length:259 Species:Anopheles gambiae


Alignment Length:285 Identity:93/285 - (32%)
Similarity:141/285 - (49%) Gaps:49/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRH 70
            :|.:| .:||...:|:.:     ||:..|  .|:|||........|||:||:..|       :.|
Mosquito     8 VVSVL-LVVSAAKVTKLV-----LDDNYV--NRVVGGEVAKNGSAPYQVSLQVPG-------WGH 57

  Fly    71 RCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDI 135
            .||||:.|:..::|||||::|.......|:.||| .....|.:..|.:::.| ..|:...::|||
Mosquito    58 NCGGSLLNDRWVLTAAHCLVGHAPGDLMVLVGTN-SLKEGGELLKVDKLLYH-SRYNLPRFHNDI 120

  Fly   136 AILFVDPPLPLN------NFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVS 194
            .::.::.|:..:      .::.||:      |...|| :::|||.||..|.|...|.:::|..:|
Mosquito   121 GLVRLEQPVRFSELVQSVEYSEKAV------PANATV-RLTGWGHTSANGPSPTLLQSLNVVTLS 178

  Fly   195 NELC-----DQDYEDFGDETYRITSAMLCA-GKRGVGGADACQGDSGGPLAVRDELYGVVSWGNS 253
            ||.|     |..|.|.|.         ||. .|.|.|   ||.|||||||....:|.|||::|..
Mosquito   179 NEDCNKKGGDPGYTDVGH---------LCTLTKTGEG---ACNGDSGGPLVYEGKLVGVVNFGVP 231

  Fly   254 CALPNYPGVYANVAYLRPWIDAVLA 278
            ||| .||..:|.|:|...|:...:|
Mosquito   232 CAL-GYPDGFARVSYYHDWVRTTMA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 83/246 (34%)
Tryp_SPc 39..276 CDD:238113 83/248 (33%)
CTR1_ANOGAXP_309033.2 Tryp_SPc 32..250 CDD:214473 83/246 (34%)
Tryp_SPc 33..253 CDD:238113 83/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.