DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP007252

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_308550.4 Gene:AgaP_AGAP007252 / 1269896 VectorBaseID:AGAP007252 Length:305 Species:Anopheles gambiae


Alignment Length:309 Identity:83/309 - (26%)
Similarity:127/309 - (41%) Gaps:66/309 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVSLVALTQGLPLLEDLD----------------------------EKSVPDG-----RIVGGYA 44
            |::|.||...:...:|:|                            .:::|.|     |||.||.
Mosquito     5 LLALFALACAVMAADDIDWSKVRPMTRMPQYWRRLPKDLLKQYLTEVRNMPAGARDNARIVNGYV 69

  Fly    45 TDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQT-- 107
            ....|.|||:::.   .|.|..  ...||||:.....::||||||  .|::...|:.|...:|  
Mosquito    70 AQPGQFPYQVAIL---STFPTG--SGLCGGSVLTANYVLTAAHCV--DVSNGGLVIYGAQDRTVN 127

  Fly   108 --GSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLA----LEQPIEGTV 166
              ....:......:.:|.. ::.|....|||.:.|..|:..:: .|:.:.|.    :.....|.:
Mosquito   128 EPSQQRIAFEQSGVRLHPN-WNPALIRYDIATIRVVSPVTFSD-RIQPVTLPRLSDVGNDFAGLI 190

  Fly   167 SKVSGWGTTSPGGYSSNQLLA-VDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADAC 230
            ..|||:|..|.....::.:|. |:.||.:|..|...:...      :....:|..  |..|..||
Mosquito   191 GTVSGFGRFSDSIQEASAILRYVNNPIQTNLACSVRFPGV------VQPENICLS--GDSGRGAC 247

  Fly   231 QGDSGGPLA-VRDEL---YGVVSWGNS--CALPNYPGVYANVAYLRPWI 273
            ||||||||. |||..   .||||:|.:  |.| |:|.|:|.......||
Mosquito   248 QGDSGGPLTIVRDGTTVQLGVVSFGLALGCEL-NWPSVFARTTSFLAWI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 73/249 (29%)
Tryp_SPc 39..276 CDD:238113 74/250 (30%)
AgaP_AGAP007252XP_308550.4 Tryp_SPc 63..295 CDD:214473 73/249 (29%)
Tryp_SPc 64..295 CDD:238113 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.