DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CLIPB1

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_307756.2 Gene:CLIPB1 / 1269160 VectorBaseID:AGAP003251 Length:372 Species:Anopheles gambiae


Alignment Length:266 Identity:85/266 - (31%)
Similarity:125/266 - (46%) Gaps:42/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLR-YKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVAS--QYKV 99
            |||||..:.|...|:...:: |||    .|.:...|||.:.:...::|||||:.|..::  .|:|
Mosquito   114 RIVGGGVSPIDGYPWLTRIQYYKG----SNRYGFHCGGVLIHNQYVLTAAHCIEGVPSTWIVYQV 174

  Fly   100 VAG-----TNFQTGSDGVITNVKEI-----VMHEGYY--SGAAYNNDIAILFVDPPLPLNNFTIK 152
            ..|     |......|.....|:::     |:|..||  :||.| ||||:|.:...:...:| |:
Mosquito   175 RLGEFDTTTTIDCVEDDCADPVRDVLINAYVVHPDYYKQNGADY-NDIALLQLSETVEFTDF-IR 237

  Fly   153 AIKLALEQP-----IEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRI 212
            .|.|...:.     :.|..:.|:|||.|. ...||.:.|.:.||:|.||:|   .:.|......|
Mosquito   238 PICLPTSEESRTVNLTGKYATVAGWGQTE-NSTSSTKKLHLRVPVVDNEVC---ADAFSSIRLEI 298

  Fly   213 TSAMLCAGKRGVGGADACQGDSGGPLAVRDE---------LYGVVSWG-NSCALPNYPGVYANVA 267
            ....||||  |..|.|:|:|||||||....:         |.|:||:| ..|.....||||..::
Mosquito   299 IPTQLCAG--GEKGKDSCRGDSGGPLMRYGDGRSSTKSWYLIGLVSFGLEQCGTDGVPGVYTRMS 361

  Fly   268 YLRPWI 273
            ....|:
Mosquito   362 EYMDWV 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 84/264 (32%)
Tryp_SPc 39..276 CDD:238113 84/265 (32%)
CLIPB1XP_307756.2 CLIP 32..85 CDD:288855
Tryp_SPc 114..367 CDD:214473 84/264 (32%)
Tryp_SPc 115..367 CDD:238113 83/263 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.