DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP012473

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_307308.4 Gene:AgaP_AGAP012473 / 1268739 VectorBaseID:AGAP012473 Length:272 Species:Anopheles gambiae


Alignment Length:241 Identity:82/241 - (34%)
Similarity:116/241 - (48%) Gaps:29/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKV-V 100
            ||||.|...:|:...|.:|:|..|        ..|||.||...:..::|||||......:.:: :
Mosquito    35 GRIVNGVPVNISNYKYALSMRLNG--------EFRCGASIITCSHALSAAHCVYNLTGPRIELTL 91

  Fly   101 AGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNN----DIAILFVDPPLPLNNFTIK--AIKLAL- 158
            .|.:....|.||...|....:|. ||...:.:|    |:|||.|    |.|:|:.:  ...||| 
Mosquito    92 YGGSTSASSGGVEFPVVGGAIHP-YYKPNSQSNTSDYDVAILNV----PANSFSGRPNMAPLALQ 151

  Fly   159 --EQPIEGTVSKVSGWGTTSPG-GYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAG 220
              |.|: ||...|.|||.|... ..|:||||..::.|||...|...:.:| ::.......|:|| 
Mosquito   152 TKELPV-GTRCFVVGWGRTGENQPVSTNQLLYANMNIVSQSSCASMWANF-EKLCAECKHMVCA- 213

  Fly   221 KRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANV 266
             :...|.|.|:|||||.|.....|.||||:|..|: ..:|.|:|.|
Mosquito   214 -QYYNGMDTCRGDSGGALVCGGRLTGVVSFGPYCS-GVWPSVFAKV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 81/240 (34%)
Tryp_SPc 39..276 CDD:238113 80/239 (33%)
AgaP_AGAP012473XP_307308.4 Tryp_SPc 36..266 CDD:214473 81/240 (34%)
Tryp_SPc 37..267 CDD:238113 80/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.