DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Ctrl

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:296 Identity:85/296 - (28%)
Similarity:130/296 - (43%) Gaps:62/296 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLVSLVALTQ----GLPLLEDLDEKSVP----DGRIVGGYATDIAQVPYQISLRYKGITTPE 65
            ||:..:|||.|..    |:|.:       .|    :.|||.|........|:|:||:       :
  Rat     3 LLSLTLSLVLLGSSWGCGVPAI-------TPALSYNQRIVNGENAVPGSWPWQVSLQ-------D 53

  Fly    66 NPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNF--------QTGSDGV-ITNVKEIVM 121
            |...|.||||:.....:||||||         ||..|.:|        .:.::.: :.::.:.:.
  Rat    54 NTGFHFCGGSLIAPNWVVTAAHC---------KVTPGRHFVILGEYDRSSNAEPIQVLSISKAIT 109

  Fly   122 HEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIE----GTVSKVSGWGTTS-PGGYS 181
            |.. ::....|||:.:|.:..|.   .:|.:...:.|....|    |.....:|||..| .|..:
  Rat   110 HPS-WNPNTMNNDLTLLKLASPA---RYTAQVSPVCLASSNEALPAGLTCVTTGWGRISGVGNVT 170

  Fly   182 SNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRD---- 242
            ..:|..|.:|:|:...|.|.:..      |||.:|:|||.   .||.:|||||||||..:.    
  Rat   171 PARLQQVVLPLVTVNQCRQYWGS------RITDSMICAGG---AGASSCQGDSGGPLVCQKGNTW 226

  Fly   243 ELYGVVSWGNSCALPNYPGVYANVAYLRPWIDAVLA 278
            .|.|:||||........|.:|..|:....||:.|:|
  Rat   227 VLIGIVSWGTENCNVQAPAMYTRVSKFNTWINQVIA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 72/252 (29%)
Tryp_SPc 39..276 CDD:238113 73/254 (29%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 72/252 (29%)
Tryp_SPc 34..260 CDD:238113 73/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.