DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss29

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:268 Identity:92/268 - (34%)
Similarity:134/268 - (50%) Gaps:49/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PDG---RIVGGYATDIAQVPYQISLRYKGITTPENPFR-------HRCGGSIFNETTIVTAAHCV 89
            |:|   .||||::....:.|:|:|||.         :|       |.|||||.:...::|||||:
Mouse    24 PEGVLMGIVGGHSAPQGKWPWQVSLRI---------YRYYWAFWVHNCGGSIIHPQWVLTAAHCI 79

  Fly    90 IGTVA--SQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF-TI 151
            ....|  |.:::..|..:..|...:: :|..:::|..:.. |...:|:|:|.:  .:.:.:| .:
Mouse    80 RERDADPSVFRIRVGEAYLYGGKELL-SVSRVIIHPDFVH-AGLGSDVALLQL--AVSVQSFPNV 140

  Fly   152 KAIKLALEQPIEGT---VSKVSGWGTTS-----PGGYSSNQLLAVDVPIVSNELCDQDYEDFGDE 208
            |.:||..|. :|.|   |..|:|||..|     |..|   :|..|.|.|:.|.||::.|.:....
Mouse   141 KPVKLPSES-LEVTKKDVCWVTGWGAVSTHRSLPPPY---RLQQVQVKIIDNSLCEEMYHNATRH 201

  Fly   209 TYR----ITSAMLCAGKRGVGGADACQGDSGGPLAVRD----ELYGVVSWGNSCALPNYPGVYAN 265
            ..|    |...|||||.:   |.|:|.|||||||....    .|.||||||..|||.::|||||.
Mouse   202 RNRGQKLILKDMLCAGNQ---GQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYAR 263

  Fly   266 VAYLRPWI 273
            |....|||
Mouse   264 VQSFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 88/260 (34%)
Tryp_SPc 39..276 CDD:238113 90/261 (34%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 90/261 (34%)
Tryp_SPc 31..271 CDD:214473 88/259 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.