DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss28

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:274 Identity:81/274 - (29%)
Similarity:112/274 - (40%) Gaps:61/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVA-- 94
            :|.|.| ||||..|...:.|:|:|||......  |.:.|.|||||.:...|:|||||:....|  
Mouse    25 RSKPVG-IVGGQCTPPGKWPWQVSLRMYSYEV--NSWVHICGGSIIHPQWILTAAHCIQSQDADP 86

  Fly    95 SQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALE 159
            :.|:|..|..: ...:..:.|:..|::|..|       ||::          ..|.:..::|...
Mouse    87 AVYRVQVGEVY-LYKEQELLNISRIIIHPDY-------NDVS----------KRFDLALMQLTAL 133

  Fly   160 QPIEGTVSKVS-----------------GWGT------TSPGGYSSNQLLAVDVPIVSNELCDQD 201
            ......||.||                 |||.      ..|    ..||..|.:||..|:.|.:.
Mouse   134 LVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQP----PYQLHEVKIPIQDNKSCKRA 194

  Fly   202 YEDFGDETYR---ITSAMLCAGKRGVGGADACQGDSGGPLAVRDE----LYGVVSWGNSCALPNY 259
            |.....:.::   |...|||||..|.|   .|.|||||||.....    ..||||.|..|: .|.
Mouse   195 YRKKSSDEHKAVAIFDDMLCAGTSGRG---PCFGDSGGPLVCWKSNKWIQVGVVSKGIDCS-NNL 255

  Fly   260 PGVYANVAYLRPWI 273
            |.:::.|.....||
Mouse   256 PSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 76/266 (29%)
Tryp_SPc 39..276 CDD:238113 78/267 (29%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 78/267 (29%)
Tryp_SPc 31..269 CDD:214473 76/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.