DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CLIPB9

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_003436374.1 Gene:CLIPB9 / 11175774 VectorBaseID:AGAP013442 Length:401 Species:Anopheles gambiae


Alignment Length:269 Identity:87/269 - (32%)
Similarity:130/269 - (48%) Gaps:53/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTV-ASQYKVVA 101
            ||.||...||.:.|:...|:|:   ..:...::.||||:.|...::||||||||.| ..:.|:|:
Mosquito   147 RIYGGQNADIDEFPWLALLQYE---NRKGERKYSCGGSLINRRYVLTAAHCVIGEVERKEGKLVS 208

  Fly   102 ----GTNFQTGSDGVI-------------TNVKEIVMHEGYYSGAAYNNDIAIL----------F 139
                ..|.:|..|.|.             ..::.:::|.| |...|:.:|||:|          |
Mosquito   209 VRLGEYNTKTEIDCVTEEQEEICADPPIDAGIESVIVHPG-YQDMAHADDIALLRLAQSIEYTSF 272

  Fly   140 VDPP-LPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSS-NQLLAVDVPIVSNELCDQDY 202
            |.|. |||.:|  :|.|       .|.|:.|:|:|.|.....|: .|.|.:.|  ..:..|.:.|
Mosquito   273 VQPVCLPLTDF--RASK-------TGEVNFVTGFGRTLQESRSAVKQKLGIKV--YDHARCQEKY 326

  Fly   203 EDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELY---GVVSWGNSCALPNYPGVYA 264
               ..:...||:..||||  |....|:|.|||||||....:::   |:||:||.|.|.::||||.
Mosquito   327 ---ATKNSSITTNQLCAG--GEYAKDSCHGDSGGPLMKLQKVWYLEGIVSYGNRCGLEDWPGVYT 386

  Fly   265 NVAYLRPWI 273
            :|.....|:
Mosquito   387 HVPAYMAWV 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 86/267 (32%)
Tryp_SPc 39..276 CDD:238113 86/268 (32%)
CLIPB9XP_003436374.1 CLIP 31..85 CDD:288855
Tryp_SPc 147..395 CDD:214473 86/267 (32%)
Tryp_SPc 148..398 CDD:238113 86/268 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.