DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and MASP2

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_006601.2 Gene:MASP2 / 10747 HGNCID:6902 Length:686 Species:Homo sapiens


Alignment Length:285 Identity:84/285 - (29%)
Similarity:129/285 - (45%) Gaps:61/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EKSVP-------------DGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTI 82
            |||:|             .|||.||........|:|:.:  .|.||        ..|::..:..:
Human   424 EKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLI--LGGTT--------AAGALLYDNWV 478

  Fly    83 VTAAHCV-------------IGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNND 134
            :||||.|             :||:    |.::....|..|:.|.       :||||...|.::||
Human   479 LTAAHAVYEQKHDASALDIRMGTL----KRLSPHYTQAWSEAVF-------IHEGYTHDAGFDND 532

  Fly   135 IAILFVDPPLPLNNFTIKAIKLALEQPIE----GTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSN 195
            ||::.::..:.:|: .|..|.|..::...    ..:...||||.|. .|:.:..|:.||:|||.:
Human   533 IALIKLNNKVVINS-NITPICLPRKEAESFMRTDDIGTASGWGLTQ-RGFLARNLMYVDIPIVDH 595

  Fly   196 ELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE------LYGVVSWGN-S 253
            :.|...||........:|:.|||||... ||.|:|:|||||.|...|.      :.|:||||: :
Human   596 QKCTAAYEKPPYPRGSVTANMLCAGLES-GGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMN 659

  Fly   254 CALPNYPGVYANVAYLRPWIDAVLA 278
            |......|||..|....|||:.:::
Human   660 CGEAGQYGVYTKVINYIPWIENIIS 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 77/258 (30%)
Tryp_SPc 39..276 CDD:238113 78/260 (30%)
MASP2NP_006601.2 CUB 28..134 CDD:214483
EGF_CA 138..176 CDD:214542
CUB 184..293 CDD:278839
CCP 300..361 CDD:214478
Sushi 366..430 CDD:278512 4/5 (80%)
Tryp_SPc 444..679 CDD:214473 77/258 (30%)
Tryp_SPc 445..682 CDD:238113 78/260 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.