DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Try5

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_008761147.1 Gene:Try5 / 103690254 RGDID:1560283 Length:246 Species:Rattus norvegicus


Alignment Length:247 Identity:87/247 - (35%)
Similarity:125/247 - (50%) Gaps:27/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVV 100
            |.:|||||......||||:||         |...|.||||:.|:..:|:||||    ..|:.:|.
  Rat    21 DDKIVGGYTCQENSVPYQVSL---------NSGYHFCGGSLINDQWVVSAAHC----YKSRIQVR 72

  Fly   101 AG---TNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPI 162
            .|   .|...|::..: |..:|:.|.. ::....||||.::.:..|:.||: .:..:.|......
  Rat    73 LGEHNINVLEGNEQFV-NAAKIIKHPN-FNARNLNNDIMLIKLSVPVTLNS-RVATVALPSSCAP 134

  Fly   163 EGTVSKVSGWGTTSPGGYSSNQLL-AVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGG 226
            .||...:||||.|...|.::..|| .:|.|::....|:..|..      :||:.|:|.|.. .||
  Rat   135 AGTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEASYPG------KITNNMICVGFL-EGG 192

  Fly   227 ADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAYLRPWIDAVLA 278
            .|:||||||||:....:|.|:||||..|||.:.||||..|.....||...:|
  Rat   193 KDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 83/238 (35%)
Tryp_SPc 39..276 CDD:238113 85/240 (35%)
Try5XP_008761147.1 Tryp_SPc 23..239 CDD:214473 83/238 (35%)
Tryp_SPc 24..242 CDD:238113 85/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.