DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and LOC102554637

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_017448472.2 Gene:LOC102554637 / 102554637 RGDID:7618053 Length:246 Species:Rattus norvegicus


Alignment Length:267 Identity:95/267 - (35%)
Similarity:130/267 - (48%) Gaps:31/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNET 80
            ||.:..|..:...:|:    |.:|||||......||||:||         |...|.||||:.|:.
  Rat     5 LVLVLVGAAVAFPVDD----DDKIVGGYTCQEHSVPYQVSL---------NSGYHYCGGSLINDQ 56

  Fly    81 TIVTAAHCVIGTVASQYKVVAG---TNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDP 142
            .:|:||||    ..|:.:|..|   .|...| |....|..:|:.|.. :.....||||.::.:..
  Rat    57 WVVSAAHC----YKSRIQVRLGEHNINVLEG-DEQFVNAAKIIKHPN-FDRKTLNNDIMLIKLSS 115

  Fly   143 PLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLL-AVDVPIVSNELCDQDYEDFG 206
            |:.| |..:..:.|.......||...:||||.|...|.:...|| .:|.|::....|:..|..  
  Rat   116 PVKL-NARVATVALPSSCAPAGTQCLISGWGNTLSFGVNDPDLLQCLDAPLLPQADCEASYPG-- 177

  Fly   207 DETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAYLRP 271
                :||:.|:|||.. .||.|:||||||||:....||.|:||||..||||:.||||..|.....
  Rat   178 ----KITNNMVCAGFL-EGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVD 237

  Fly   272 WIDAVLA 278
            ||...:|
  Rat   238 WIQDTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 87/238 (37%)
Tryp_SPc 39..276 CDD:238113 89/240 (37%)
LOC102554637XP_017448472.2 Tryp_SPc 24..242 CDD:238113 89/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.