DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Klk15

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_038952112.1 Gene:Klk15 / 102553035 RGDID:1310995 Length:169 Species:Rattus norvegicus


Alignment Length:272 Identity:61/272 - (22%)
Similarity:89/272 - (32%) Gaps:114/272 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFR 69
            |:  ||||::.:.|...|..:||  .|:.||..:            |:|::|..:|        |
  Rat     2 WL--LLAFILLVSAAQDGDKVLE--GEECVPHSQ------------PWQVALFERG--------R 42

  Fly    70 HRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDG--VITNVKEIVMHEGYYSGAAYN 132
            ..||..:.:...::|||||....:    :|..|.:.....||  .:.:|..|:.|.| |....:.
  Rat    43 FNCGAFLISPHWVLTAAHCQTRFM----RVRLGEHNLRKFDGPEQLRSVSRIIPHPG-YEARTHR 102

  Fly   133 NDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNEL 197
            :||.:|.:..|.                                                     
  Rat   103 HDIMLLRLFRPA----------------------------------------------------- 114

  Fly   198 CDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGN-SCALPNYPG 261
                         |:|.                ||||||||.....|.|:||||: .|.....||
  Rat   115 -------------RLTP----------------QGDSGGPLVCGGALQGIVSWGDVPCDTTTKPG 150

  Fly   262 VYANVAYLRPWI 273
            ||..|.....||
  Rat   151 VYTKVCSYMDWI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 47/237 (20%)
Tryp_SPc 39..276 CDD:238113 49/238 (21%)
Klk15XP_038952112.1 Tryp_SPc 23..165 CDD:238113 52/247 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.