DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and tmprss2.15

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:275 Identity:100/275 - (36%)
Similarity:133/275 - (48%) Gaps:40/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQIS-LRYKGITTPENPFRHRCGGSI 76
            :|||..::.||        .:..|.|||||....:...|:|:. |:..|.:.      :.|||||
 Frog   247 MVSLRCISCGL--------STKVDSRIVGGTPASVGDWPWQVELLKLVGTSI------YLCGGSI 297

  Fly    77 FNETTIVTAAHCVIGTVA--SQYKVVAGT-NFQTGSDGVITNVKEIVMHEGYYSGAAYNN--DIA 136
            .....||||||||.|:.:  |.:||.||: ..|:......| |:..::|..|   ::|..  |:|
 Frog   298 ITPHWIVTAAHCVYGSTSTPSAFKVFAGSLTIQSYYSAGYT-VERALVHPSY---SSYTQIYDVA 358

  Fly   137 ILFVDPPLPLNNFTIKAIKLALEQP----IEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNEL 197
            :|.:...|.   ||.....:.|...    .||....:||||||:.||..|..|:|..|||:|:..
 Frog   359 LLKLTAALV---FTTNLRPVCLPNVGMPWAEGQPCWISGWGTTAEGGSISKNLMAASVPIISSTT 420

  Fly   198 CDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE----LYGVVSWGNSCALPN 258
            |:|.....|    .|:|.|:|||... ||.|.|||||||||..:..    |.|..|||..||...
 Frog   421 CNQAAVYGG----AISSTMMCAGYLS-GGTDTCQGDSGGPLVTKTNSLWWLVGDTSWGYGCARAY 480

  Fly   259 YPGVYANVAYLRPWI 273
            .||||.||.....||
 Frog   481 KPGVYGNVTVFIEWI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 92/248 (37%)
Tryp_SPc 39..276 CDD:238113 93/249 (37%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055 5/19 (26%)
Tryp_SPc 265..498 CDD:238113 93/249 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.