DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and LOC101732176

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:297 Identity:106/297 - (35%)
Similarity:139/297 - (46%) Gaps:48/297 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSWIVGLL------------AFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQ 53
            :.||.:.|.|            ..:|||..:..||        .:..|.|||||........|:|
 Frog   235 LKSSTVTGKLYKNLQYSATCTTGTMVSLRCINCGL--------STKVDNRIVGGTFALAGDWPWQ 291

  Fly    54 ISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQ--YKVVAG----TNFQTGSDGV 112
            ||| .|.:.|.    .:.|||||.....||||||||.|..:|.  :||.||    :|:.  |.|.
 Frog   292 ISL-MKLVGTS----LYLCGGSIITPYWIVTAAHCVYGYTSSPSIFKVFAGSLTLSNYY--SAGY 349

  Fly   113 ITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLA-LEQP-IEGTVSKVSGWGTT 175
            :  |..:::|.. ||....|.|||:|.:...|..:. .::.:.|. :..| .:|....:||||||
 Frog   350 L--VDRVLIHPS-YSPNTQNYDIALLKLKTALVFST-NLRPVCLPNVGMPWADGQPCWISGWGTT 410

  Fly   176 SPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAV 240
            |..|..|..|.|..|||:|:..|:. ...:|..   |:..|:|||..| ||.|.|||||||||..
 Frog   411 SEAGSISTSLKAASVPIISSATCNL-APVYGGV---ISPTMICAGYLG-GGTDTCQGDSGGPLVT 470

  Fly   241 RDE----LYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            :..    |.|..|||..||....||||.|:.....||
 Frog   471 KTNSLWWLVGDTSWGYGCARAYKPGVYGNITVFLEWI 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 94/246 (38%)
Tryp_SPc 39..276 CDD:238113 95/247 (38%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055 9/43 (21%)
Tryp_SPc 277..510 CDD:238113 95/247 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.