DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and LOC101731336

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_004916443.1 Gene:LOC101731336 / 101731336 -ID:- Length:300 Species:Xenopus tropicalis


Alignment Length:77 Identity:21/77 - (27%)
Similarity:32/77 - (41%) Gaps:15/77 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 ELCDQDYE-DFGDETYRI-TSAMLCAG---KRGVGGADA--CQGDSGGPL------AVRDELYGV 247
            :||:::.| |.|.:..:. |..:.|.|   :.|.||...  |:......:      ||..|.|.|
 Frog    99 DLCNKELEPDLGPDAQKWGTECLACNGPPTECGGGGLPGLRCKTSQSSCIQVSIATAVEKESYKV 163

  Fly   248 V--SWGNSCALP 257
            :  |..||...|
 Frog   164 MIKSCSNSSVCP 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 21/77 (27%)
Tryp_SPc 39..276 CDD:238113 21/77 (27%)
LOC101731336XP_004916443.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.