DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and LOC101730924

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_031761513.1 Gene:LOC101730924 / 101730924 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:247 Identity:86/247 - (34%)
Similarity:122/247 - (49%) Gaps:27/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVV 100
            |.:|:||.......|||.:||         |...|.||||:.|...:|:||||...::    :|.
 Frog    18 DDKIIGGATCAKNSVPYIVSL---------NSGYHFCGGSLINNQWVVSAAHCYKASI----QVR 69

  Fly   101 AGTN---FQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPI 162
            .|.:   ...|::..|::.| ::.|.||.|. ..:|||.::.:.....| |..:.|:.|......
 Frog    70 LGEHNIALSEGTEQFISSSK-VIRHSGYNSW-TLDNDIMLIKLSSAASL-NAAVNAVALPSGCAA 131

  Fly   163 EGTVSKVSGWGTTSPGGYSSNQLL-AVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGG 226
            .||...:||||.|...|.:...|| .:..||:::..|:..|..      .||:.|:|.|.. .||
 Frog   132 AGTSCLISGWGNTLSSGSNYPDLLQCLYAPILTDAQCNNAYPG------EITNNMICLGFL-EGG 189

  Fly   227 ADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAYLRPWIDAVLA 278
            .|:||||||||:....:|.||||||..||..||||||..|.....||.:.:|
 Frog   190 KDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYNSWIQSTIA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 82/238 (34%)
Tryp_SPc 39..276 CDD:238113 84/240 (35%)
LOC101730924XP_031761513.1 Tryp_SPc 21..239 CDD:238113 84/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.