DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Klk9

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:283 Identity:85/283 - (30%)
Similarity:123/283 - (43%) Gaps:49/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHR 71
            :||...|.||:|...|            .|.|.||.........|:|..|.|  :|      |..
Mouse     3 LGLTLVLFSLLAGHCG------------ADTRAVGARECVRNSQPWQAGLFY--LT------RQL 47

  Fly    72 CGGSIFNETTIVTAAHCVIGTVASQYK-VVAGTNFQTGSDG--VITNVKEIVMHEGY---YSGAA 130
            ||.::.|:..::|||||     ...|. |..|.:.....:|  .:..|.:...|.|:   .|...
Mouse    48 CGATLINDQWLLTAAHC-----RKPYLWVRLGEHHLWRWEGPEQLLLVTDFFPHPGFNPDLSAND 107

  Fly   131 YNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSN-----QLLAVDV 190
            :|:||.::.:...:.|.. .::.:.|...:|..||...:||||:.|    ||.     .|...::
Mouse   108 HNDDIMLIRLPRKVRLTP-AVQPLNLTESRPPVGTQCLISGWGSVS----SSKLQYPMTLQCANI 167

  Fly   191 PIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNS-C 254
            .|:.|:||...|..      .|:..||||| ...||..:|||||||||.....|.|:||.|:. |
Mouse   168 SILDNKLCRWAYPG------HISEKMLCAG-LWEGGRGSCQGDSGGPLVCEGTLAGIVSGGSEPC 225

  Fly   255 ALPNYPGVYANVAYLRPWIDAVL 277
            :.|..|.||.||.....||::.:
Mouse   226 SRPRRPAVYTNVFDYLEWIESTM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 75/246 (30%)
Tryp_SPc 39..276 CDD:238113 76/248 (31%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 76/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.