DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and mst1

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_004915630.2 Gene:mst1 / 100494056 XenbaseID:XB-GENE-487985 Length:736 Species:Xenopus tropicalis


Alignment Length:261 Identity:71/261 - (27%)
Similarity:117/261 - (44%) Gaps:37/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVA 94
            :::|....|||||..   ...|:.:|||       .....|.||||:..|..:::...|.....|
 Frog   497 NDRSSQRTRIVGGMP---GNSPWTVSLR-------NRQGEHFCGGSLVKENWVISTRQCFSSCDA 551

  Fly    95 --SQYKVVAGTNFQTGS----DGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKA 153
              |.|:.|.||.|:..|    |.....:.:||.       ...::.:.:|.::.|:.||: .:..
 Frog   552 DLSGYQAVMGTLFKNPSPDDPDRQSVPISKIVC-------GPSDSSLVMLKLERPVTLNS-RVAL 608

  Fly   154 IKLALEQPI--EGTVSKVSGWGTTSPGGYSSNQLLAVDV-PIVSNELCDQDYEDFGDETYRITSA 215
            |.|..|:.|  |.|..:::|||.|  ||...:.:|.:.: .|:||:.|:::|.   .:..::...
 Frog   609 ICLPPERYIVPEATKCEIAGWGDT--GGTGHDNVLKIAIFHIISNDECNKNYR---SQRNKVLDN 668

  Fly   216 MLCAGKRGVGGADACQGDSGGPLAVRDE----LYGVVSWGNSCALPNYPGVYANVAYLRPWIDAV 276
            .:|.....| ...||:||.|||||....    |.||:.....|...|.|.::..|:....||:.|
 Frog   669 EMCTKPVPV-DVGACEGDYGGPLACLTHDCWVLEGVIVPARGCGKKNQPAIFTRVSVYVDWINKV 732

  Fly   277 L 277
            :
 Frog   733 M 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 67/247 (27%)
Tryp_SPc 39..276 CDD:238113 68/249 (27%)
mst1XP_004915630.2 PAN_AP_HGF 36..114 CDD:238532
KR 118..198 CDD:214527
KR 201..279 CDD:214527
KR 308..390 CDD:214527
KR 397..474 CDD:412161
Tryp_SPc 506..732 CDD:238113 68/249 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.