DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and f12

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_017947702.2 Gene:f12 / 100493769 XenbaseID:XB-GENE-1004811 Length:597 Species:Xenopus tropicalis


Alignment Length:258 Identity:93/258 - (36%)
Similarity:118/258 - (45%) Gaps:41/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCV--------IGTVA 94
            |||||.....|..||..:|...         .|.||||:.:...|||||||:        |..|.
 Frog   358 RIVGGLVALPASHPYIAALYID---------NHFCGGSLISPCWIVTAAHCLDQRPNVTKISVVL 413

  Fly    95 SQYKVVAGTNFQTGSDGVIT-NVKEIVMHEGYYSGAAYNNDIAILFVDP--PLPLNNFTIKAIKL 156
            .|      :.|.|.....:| .|::.::||.|| |....:|||::.|..  .|..:.|:.....:
 Frog   414 GQ------SRFNTTDQHTVTLLVEKYILHEKYY-GDTLQHDIALVKVKSINGLCASEFSQFVQPI 471

  Fly   157 ALEQPIEGTVSK----VSGWGTTSPGG-YSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAM 216
            .|.|..:...|.    |:|||....|. :.:..|....:||:....| |.....||   |:...|
 Frog   472 CLPQQFKMAESTKQCVVAGWGHQYEGAEHYAFFLQEASMPIIPYTQC-QSPSVHGD---RMLPGM 532

  Fly   217 LCAGKRGVGGADACQGDSGGPLAV----RDELYGVVSWGNSCALPNYPGVYANVAYLRPWIDA 275
            ||||.. .||.|||||||||||..    |.||:||||||:.||..|.||||..|.....||.|
 Frog   533 LCAGFM-EGGVDACQGDSGGPLVCEVDGRIELHGVVSWGSGCAEENKPGVYTAVTSYTDWIRA 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 90/254 (35%)
Tryp_SPc 39..276 CDD:238113 92/257 (36%)
f12XP_017947702.2 fn2 46..87 CDD:394995
EGF_CA 95..129 CDD:238011
KR 213..298 CDD:214527
Tryp_SPc 359..595 CDD:238113 92/257 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.