DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and tmprss3

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_031752328.1 Gene:tmprss3 / 100490444 XenbaseID:XB-GENE-994580 Length:483 Species:Xenopus tropicalis


Alignment Length:244 Identity:93/244 - (38%)
Similarity:126/244 - (51%) Gaps:23/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQ-YKVVA 101
            |||||..:.:.|.|:|.||.::|:        |.||||:.....||||||||...:..: ::|..
 Frog   243 RIVGGNVSAVGQWPWQASLVFQGV--------HLCGGSLITPQWIVTAAHCVYDLLYPEWWRVQV 299

  Fly   102 GTNFQTG-SDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLA--LEQPIE 163
            |...|.. |......|::|:.|..|.| :...||||::.:..|...|. :|:.|.|.  .|...|
 Frog   300 GQVSQASESAQTAVPVQKIIYHSKYRS-STMANDIALIRLASPFTFNG-SIQPICLPNYREDFPE 362

  Fly   164 GTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGAD 228
            |.:..:||||.|..||.:|..:....||::||.:|:..|...|    .|..:|:|||.. .||.|
 Frog   363 GKICWISGWGATEEGGDTSQTMDYAGVPLISNRVCNTKYIYGG----VIKPSMVCAGFL-EGGVD 422

  Fly   229 ACQGDSGGPLAVRD----ELYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            .||||||||||..|    :|.|..|||..|||...||||..::....||
 Frog   423 TCQGDSGGPLACEDSNVWKLMGTTSWGIGCALRYKPGVYTRISSFLDWI 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 91/242 (38%)
Tryp_SPc 39..276 CDD:238113 92/243 (38%)
tmprss3XP_031752328.1 LDLa 96..128 CDD:197566
SRCR_2 136..236 CDD:406055
Tryp_SPc 244..472 CDD:238113 92/243 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.