powered by:
Protein Alignment zetaTry and akt1
DIOPT Version :9
Sequence 1: | NP_523691.1 |
Gene: | zetaTry / 36216 |
FlyBaseID: | FBgn0011556 |
Length: | 280 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004917247.1 |
Gene: | akt1 / 100490038 |
XenbaseID: | XB-GENE-484953 |
Length: | 493 |
Species: | Xenopus tropicalis |
Alignment Length: | 32 |
Identity: | 11/32 - (34%) |
Similarity: | 17/32 - (53%) |
Gaps: | 2/32 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 145 PLNNFTI-KAIKLALEQPIEGT-VSKVSGWGT 174
|||||:: |...:..|:|...| :.:...|.|
Frog 51 PLNNFSVAKCQLMKTERPKPNTFIIRCLQWTT 82
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E33208_3BBP0 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.