DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and akt1

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_004917247.1 Gene:akt1 / 100490038 XenbaseID:XB-GENE-484953 Length:493 Species:Xenopus tropicalis


Alignment Length:32 Identity:11/32 - (34%)
Similarity:17/32 - (53%) Gaps:2/32 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 PLNNFTI-KAIKLALEQPIEGT-VSKVSGWGT 174
            |||||:: |...:..|:|...| :.:...|.|
 Frog    51 PLNNFSVAKCQLMKTERPKPNTFIIRCLQWTT 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 11/32 (34%)
Tryp_SPc 39..276 CDD:238113 11/32 (34%)
akt1XP_004917247.1 PH_PKB 4..111 CDD:269947 11/32 (34%)
PKc_like 125..491 CDD:419665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.