DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and zfand4

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_012822294.1 Gene:zfand4 / 100144290 XenbaseID:XB-GENE-6258311 Length:701 Species:Xenopus tropicalis


Alignment Length:167 Identity:30/167 - (17%)
Similarity:57/167 - (34%) Gaps:52/167 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSG 128
            |..|||:                .|.||.|..::|:..|....:.::..:..|.:.:..|...:|
 Frog   383 PIEPFRN----------------VCTIGQVKPEFKLTEGRKDPSATETSLRPVSKSLNPEAMDTG 431

  Fly   129 --------------AAYNNDIAILFVDPP--------LPLNNF----------TIKAIKLALEQP 161
                          ...|....|..:.||        ....||          :::|..:| ::.
 Frog   432 INTSDLSPARSKLLTPVNFPSQISHLSPPSLQCQSKCFETGNFRTPTSQNLFRSVEARNIA-DRS 495

  Fly   162 IEGTVSKVSGWGTTSPGGYSS--NQLLAVDVPIVSNE 196
            ...| ::..|....|||..|.  :::.|.|:..::|:
 Frog   496 FSRT-ARFRGVKVNSPGKQSEVISKMEARDITELANK 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 30/167 (18%)
Tryp_SPc 39..276 CDD:238113 30/167 (18%)
zfand4XP_012822294.1 Ubl_ZFAND4 28..101 CDD:340500
ZnF_AN1 641..679 CDD:197545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.