DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and si:dkey-78l4.13

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_003201101.3 Gene:si:dkey-78l4.13 / 100034660 ZFINID:ZDB-GENE-060503-459 Length:253 Species:Danio rerio


Alignment Length:279 Identity:85/279 - (30%)
Similarity:125/279 - (44%) Gaps:52/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNET 80
            ||.|...|.|     :.||..|.:.|..|...:: ||.:|::...        :|.|||.:.:|.
Zfish     8 LVYLLPNLTL-----QASVKSGIVNGNEARPHSR-PYMVSVQCNR--------KHICGGFLVSEQ 58

  Fly    81 TIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVI-TNVKEIVMHEGYYSGAAYNNDIAILFVDP-- 142
            .::|||||.:.  ..:..||.|.:..|  ||.. .:||...:|.|:.|.... |||.:|.:..  
Zfish    59 FVMTAAHCFVN--GKELTVVVGAHEYT--DGASRMDVKFYHIHPGFESKTLL-NDIMLLQLHKKV 118

  Fly   143 ---------PLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELC 198
                     |:|..:..|||          .|...|:|||..:..|..|.:|:.|:|.:...:.|
Zfish   119 KKSNKVNWIPIPNADKDIKA----------KTKCSVAGWGKNTTHGEVSAKLMEVNVTLFDKKAC 173

  Fly   199 DQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWG--NSCALPNYPG 261
                :.:...||. ||.|:|.|  |.||  .|||||||||.......|:||:.  |:|..|..|.
Zfish   174 ----QKYWGPTYS-TSKMMCTG--GHGG--FCQGDSGGPLVCDKVAVGIVSFNEKNNCDSPTKPN 229

  Fly   262 VYANVAYLRPWIDAVLAGL 280
            ||..::....||..::.|:
Zfish   230 VYTQISKFLSWIKCIVGGV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 74/248 (30%)
Tryp_SPc 39..276 CDD:238113 76/250 (30%)
si:dkey-78l4.13XP_003201101.3 Tryp_SPc 25..242 CDD:238113 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.