DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and tmprss3a

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:244 Identity:89/244 - (36%)
Similarity:122/244 - (50%) Gaps:24/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAG 102
            |||||..:...|.|:|:||.::.        .|.|||||.....|:||||||.|.....|.:|..
Zfish   297 RIVGGNLSAEGQFPWQVSLHFQN--------EHLCGGSIITSRWILTAAHCVYGIAYPMYWMVYA 353

  Fly   103 TNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLAL--EQPIEGT 165
            ...:...:.|.....|.:::...|.....::|||::.:..||..|.. ::.|.|..  ||..:|.
Zfish   354 GLTELPLNAVKAFAVEKIIYHSRYRPKGLDHDIALMKLAQPLTFNGM-VEPICLPNFGEQFEDGK 417

  Fly   166 VSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYR--ITSAMLCAGKRGVGGAD 228
            :..:||||.|..||.:|.......||::||:.|.|      .|.|:  :|:.|:|||... ||.|
Zfish   418 MCWISGWGATEDGGDASVSQHCASVPLISNKACSQ------PEVYQGYLTAGMICAGYLD-GGTD 475

  Fly   229 ACQGDSGGPLAVRD----ELYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            :||||||||||..|    :|.|..|||..||..|.||||..:.....||
Zfish   476 SCQGDSGGPLACEDSSIWKLVGATSWGQGCAEKNKPGVYTRITQSLTWI 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 87/242 (36%)
Tryp_SPc 39..276 CDD:238113 88/243 (36%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845
Tryp_SPc 298..525 CDD:238113 88/243 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.