DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and st14b

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_005161261.1 Gene:st14b / 777629 ZFINID:ZDB-GENE-061103-613 Length:864 Species:Danio rerio


Alignment Length:265 Identity:87/265 - (32%)
Similarity:118/265 - (44%) Gaps:62/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQCLYGLPEETKLVAVAGA 89
            ||:.|...|....|:.|||..:...     |.|...:||...|:|:|.|:               
Zfish   624 RIVGGKDSDEGEWPWQVSLHMKTQG-----HVCGASVISNSWLVTAAHCV--------------- 668

  Fly    90 NTRNGTDGFIYPVAN-W-----TH------------------HPNYDPVTVDNDIGVLLLDT--T 128
               ...|.|.|..|: |     .|                  ||.||..:.||||.::.||:  |
Zfish   669 ---QDNDQFRYSQADQWEVYLGLHNQGETSKSTQRSVLRIIPHPQYDHSSYDNDIALMELDSPVT 730

  Fly   129 LDLTLLGISSIGIRPERPAVGRLATVAGWGYREEWG---PSSYKLEQTEVPVVSSEQCTQIYGAG 190
            |:..:..|.........|| |:...:.|||...|..   ||  .|::.||.:::|..|:::...|
Zfish   731 LNQNIWPICLPDPTHYFPA-GKSVWITGWGKLREGSDAVPS--VLQKAEVRIINSTVCSKLMDDG 792

  Fly   191 EVTERMICAGFVVQGGSDACQGDTGGPL-VIDGQ----LVGLVSWGRGCARPNYPTVYCYVASFV 250
             :|..||||| |:.||.||||||:|||: .|:|.    |.|:||||.||.|.|.|.||..|..:.
Zfish   793 -ITPHMICAG-VLSGGVDACQGDSGGPMSSIEGNGRMFLAGVVSWGDGCGRRNRPGVYTRVTDYR 855

  Fly   251 DWIEE 255
            .||.|
Zfish   856 SWIRE 860

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 84/261 (32%)
Tryp_SPc 26..256 CDD:238113 86/264 (33%)
st14bXP_005161261.1 SEA 92..180 CDD:279699
CUB 233..342 CDD:238001
CUB 351..457 CDD:238001
LDLa 465..497 CDD:238060
LDLa 499..533 CDD:238060
LDLa 536..570 CDD:238060
LDLa 578..613 CDD:238060
Tryp_SPc 624..858 CDD:214473 84/261 (32%)
Tryp_SPc 625..861 CDD:238113 86/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.