DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and Prss54

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_006531428.1 Gene:Prss54 / 70993 MGIID:1918243 Length:429 Species:Mus musculus


Alignment Length:281 Identity:69/281 - (24%)
Similarity:117/281 - (41%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLLAIGFSSVISISGQPEGRI---INGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQA 66
            |:||.|..|| .:|.|..:..|   :....|.....|::||::     :..|.|...|.|:||..
Mouse    55 LMLLYISHSS-SAICGIQKATIADKLKENLVSSTEFPWVVSIQ-----DKQYTHLAFGCILSEFW 113

  Fly    67 LITSAQCLYGLPEETKLVAVAGANTRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTLDL 131
            ::::|..|....|...:|.::..:.|. ||...|.|.....|.|:|.|::.|:|.:|..::.:..
Mouse   114 ILSTASALQHRKEVIAVVGISNMDPRK-TDHREYSVNTIIPHENFDNVSMGNNIALLKTESAMHF 177

  Fly   132 TLL--GISSIGIRPERPAVGRLATVAGWGYREEWGPSS-------------YKLEQTEVPVVSSE 181
            ..|  .|..:|.:..:|...:...|||      |.|:|             ..::..||..:...
Mouse   178 NDLVQAICFLGKKLHKPPALKNCWVAG------WNPTSATGNHMTMSILRRISVKDIEVCPLRRH 236

  Fly   182 QCTQIYGAGEVTERMICAGFVVQGGSDACQGDTGGPLVIDGQ------LVGLVSWGRGCARPNYP 240
            |.|:            ||....: .::.|.|:.|.|::...:      |.||:::| |.:.|.. 
Mouse   237 QKTE------------CASHTKE-PNNVCLGEPGSPMMCQAKKLDLWILRGLLAYG-GDSCPGL- 286

  Fly   241 TVYCYVASFVDWIEETIAAAG 261
            .:|..||.:.|||......||
Mouse   287 FLYTSVADYSDWITAKTRKAG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 57/251 (23%)
Tryp_SPc 26..256 CDD:238113 59/253 (23%)
Prss54XP_006531428.1 Tryp_SPc 88..299 CDD:238113 55/237 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7758
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.