DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and ST14

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens


Alignment Length:263 Identity:78/263 - (29%)
Similarity:122/263 - (46%) Gaps:53/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQC-------------- 73
            :.|::.||..|....|:.|||     :.....|.|...:||...|:::|.|              
Human   612 QARVVGGTDADEGEWPWQVSL-----HALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQ 671

  Fly    74 ---LYGLPEETKLVAVAGANTRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTLDLTLLG 135
               ..||.::::..| .|...|.        :.....||.::..|.|.||.:|.|:...:.:.: 
Human   672 WTAFLGLHDQSQRSA-PGVQERR--------LKRIISHPFFNDFTFDYDIALLELEKPAEYSSM- 726

  Fly   136 ISSIGIRP--------ERPAVGRLATVAGWGYREEWGPSSYKLEQTEVPVVSSEQCTQIYGAGEV 192
                 :||        ..|| |:...|.|||:.:..|..:..|::.|:.|::...|..:. ..::
Human   727 -----VRPICLPDASHVFPA-GKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLL-PQQI 784

  Fly   193 TERMICAGFVVQGGSDACQGDTGGPL---VIDGQL--VGLVSWGRGCARPNYPTVYCYVASFVDW 252
            |.||:|.|| :.||.|:||||:||||   ..||::  .|:||||.|||:.|.|.||..:..|.||
Human   785 TPRMMCVGF-LSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDW 848

  Fly   253 IEE 255
            |:|
Human   849 IKE 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 75/257 (29%)
Tryp_SPc 26..256 CDD:238113 77/260 (30%)
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>171 CDD:307516
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 77/260 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.