DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and Klk13

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001034131.2 Gene:Klk13 / 626834 MGIID:3615275 Length:276 Species:Mus musculus


Alignment Length:216 Identity:69/216 - (31%)
Similarity:107/216 - (49%) Gaps:29/216 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CAGVIISEQALITSAQCL---YGLPEETKLVAVAGANTRNGTDGFIYPVANWTHHPNYD--PVTV 116
            |.||::..:.::|:|.|.   |    ...|...|.....||....  .|.....||.|.  |..:
Mouse    62 CGGVLVHPKWVLTAAHCRKDGY----TVHLGKHALGRVENGEQAM--EVVRSIPHPEYQVTPTHL 120

  Fly   117 DNDIGVLLLDTTLDLTL------LGISSIGIRPERPAVGRLATVAGWGYREEWGPS-SY--KLEQ 172
            ::|..::||:....:.|      |.:|:....|    .|....|:|||  ....|. :|  .|:.
Mouse   121 NHDHDIMLLELKSPVQLSSHVRTLKLSADDCLP----TGTCCRVSGWG--TTTSPQVNYPKTLQC 179

  Fly   173 TEVPVVSSEQCTQIYGAGEVTERMICAGFVVQGGSDACQGDTGGPLVIDGQLVGLVSWGR-GCAR 236
            ..:.:.|.|:|.|:| .|::|..|:||| ..:||.|:|:||:||||:.:|:|.|::|||. .|.:
Mouse   180 ANIELRSDEECRQVY-PGKITANMLCAG-TKEGGKDSCEGDSGGPLICNGKLYGIISWGDFPCGQ 242

  Fly   237 PNYPTVYCYVASFVDWIEETI 257
            ||.|.||..|:.::.||.|.|
Mouse   243 PNRPGVYTRVSKYLRWIREII 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 65/210 (31%)
Tryp_SPc 26..256 CDD:238113 67/213 (31%)
Klk13NP_001034131.2 Tryp_SPc 39..262 CDD:238113 67/213 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.