DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and CG18754

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:268 Identity:65/268 - (24%)
Similarity:103/268 - (38%) Gaps:54/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GQ--PEGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQCLYG--LPEE 80
            ||  |..|.......::..:|::|.|.|  :|..|.:          :.::|:|.|:.|  |.:.
  Fly    98 GQTTPVFRDRGAENAELNEYPWMVLLLY--ENRLSLI----------RYVLTAAHCVIGGYLTQN 150

  Fly    81 ---TKLVAVAGANTRNGTDGFIYP-----VANWTHHPNYDPV--TVDNDIGVLLLDTTLDLTLLG 135
               .|.|.:..:.|...|.....|     |...|.|..:...  |..|||.:|.|...:..|.  
  Fly   151 DLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTK-- 213

  Fly   136 ISSIGIRP------ERPAVGRLATVAGWGYREEWGPSSYKLEQTEVPVVSSEQCTQIYGAGEVTE 194
                .|:|      |.|.......::||...:    ||..|..:.|...:...|...|.:.. :.
  Fly   214 ----KIQPICLLDAEFPLQDLNLQISGWDPTK----SSQTLITSTVKERNPADCLNRYPSFR-SA 269

  Fly   195 RMICAGFVVQGGSDACQGDTGGPLV-IDGQ-------LVGLVSWGRG-CARPNYPTVYCYVASFV 250
            ..:|||...:|  |.|.|.:|.|:: |.|.       |.|:.|:|:. |.....|.||..:..|.
  Fly   270 SQVCAGGQRKG--DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFS 332

  Fly   251 DWIEETIA 258
            :||:..:|
  Fly   333 EWIKANLA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 59/254 (23%)
Tryp_SPc 26..256 CDD:238113 60/256 (23%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 60/254 (24%)
Tryp_SPc 108..335 CDD:214473 58/251 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7758
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.