DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and tmprss5

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:258 Identity:98/258 - (37%)
Similarity:134/258 - (51%) Gaps:45/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQCL--YGLPEETKLVAVA 87
            |||.|....:.|.|:.|||.|..      .|.|.|.||:.|.::|:|.|:  |.||:....|..|
Zfish   311 RIIGGVEAALGRWPWQVSLYYNN------RHICGGSIITNQWIVTAAHCVHNYRLPQVPSWVVYA 369

  Fly    88 GANTRN-----GTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTLDLTLLGISSIGIRP---- 143
            |..|.|     ...||  .|....::.||:..|.||||.::.|.|.|:.      |..|||    
Zfish   370 GIITSNLAKLAQYQGF--AVERIIYNKNYNHRTHDNDIALVKLKTPLNF------SDTIRPVCLP 426

  Fly   144 ----ERPAVGRLATVAGWGYREEWGPSSY----KLEQTEVPVVSSEQCTQ--IYGAGEVTERMIC 198
                :.|. |....::||||.:   |...    .|::..||::|:::|..  :|. ||:|.||:|
Zfish   427 QYDHDLPG-GTQCWISGWGYTQ---PDDVLIPEVLKEAPVPLISTKKCNSSCMYN-GEITSRMLC 486

  Fly   199 AGFVVQGGSDACQGDTGGPLVIDGQ----LVGLVSWGRGCARPNYPTVYCYVASFVDWIEETI 257
            ||: .:|..||||||:|||||...:    |||:||||.|||.||:|.||..||.|:.||.:.|
Zfish   487 AGY-SEGKVDACQGDSGGPLVCQDENVWRLVGVVSWGTGCAEPNHPGVYSKVAEFLGWIYDII 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 95/252 (38%)
Tryp_SPc 26..256 CDD:238113 96/254 (38%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133
Tryp_SPc 311..544 CDD:214473 95/252 (38%)
Tryp_SPc 312..547 CDD:238113 96/254 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.