DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and KLK6

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001012982.1 Gene:KLK6 / 5653 HGNCID:6367 Length:244 Species:Homo sapiens


Alignment Length:255 Identity:75/255 - (29%)
Similarity:121/255 - (47%) Gaps:18/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAIGFSSVISISGQPEGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQ 72
            |.:..|.:.:...:.:.::::|...|...|||..:|     ..|.:: .|.||:|....::|:|.
Human     4 LMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAAL-----YTSGHL-LCGGVLIHPLWVLTAAH 62

  Fly    73 CLYGLPEETKLVAVAGANT--RNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTLDLTLLG 135
            |     ::..|....|.:.  :..:......|.....||:||..:.|.||.:|.|.....|:.| 
Human    63 C-----KKPNLQVFLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSEL- 121

  Fly   136 ISSIGIRPERPAVGRLATVAGWGYREEWGPSSYKLEQTEVPVVSSEQCTQIYGAGEVTERMICAG 200
            |..:.:..:..|......:.|||...: |.....::...:.:||.|:|...| .|::|:.|:|||
Human   122 IQPLPLERDCSANTTSCHILGWGKTAD-GDFPDTIQCAYIHLVSREECEHAY-PGQITQNMLCAG 184

  Fly   201 FVVQGGSDACQGDTGGPLVIDGQLVGLVSWGR-GCARPNYPTVYCYVASFVDWIEETIAA 259
             ..:.|.|:||||:|||||....|.||||||. .|.....|.||..|..:.:||::||.|
Human   185 -DEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQA 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 68/230 (30%)
Tryp_SPc 26..256 CDD:238113 70/232 (30%)
KLK6NP_001012982.1 Tryp_SPc 23..237 CDD:214473 68/228 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.