DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and prss60.2

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:283 Identity:94/283 - (33%)
Similarity:137/283 - (48%) Gaps:49/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IPLLLLAIGFSSVISISGQP--EGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQ 65
            :.||:...|..|.:::.||.  ..||:.|........|:.|||:..|...    |.|.|.:||.:
Zfish     9 LTLLICVKGSLSQLNVCGQAPLNSRIVGGVNAPEGSWPWQVSLQSPRYGG----HFCGGSLISSE 69

  Fly    66 ALITSAQCLYGLPEETKLVAVAGANTRNGTDGFIYPVANWTH-----------HPNYDPVTVDND 119
            .::|:|.||.|: .|:.||...|..|:.|.:         ||           |.:|:..|.|||
Zfish    70 WVLTAAHCLPGV-SESSLVVYLGRRTQQGVN---------THETSRNVAKIIVHSSYNSNTNDND 124

  Fly   120 IGVLLLDTTLDLTLLGISSIGIRPERPA-------VGRLATVAGWGYREEWG---PSSYKLEQTE 174
            |.:|.|.:.:..      :..|||...|       .|..:.:.||| ..:.|   |:...|::|.
Zfish   125 IALLRLSSAVTF------NDYIRPVCLAAQNSVYSAGTSSWITGWG-DVQAGVNLPAPGILQETM 182

  Fly   175 VPVVSSEQCTQIYGAGEVTERMICAGFVVQGGSDACQGDTGGPLVIDGQLV----GLVSWGRGCA 235
            :|||::::|....|:|.||..||||| :.:||.|.||||:|||:|.....|    |:.|||.|||
Zfish   183 IPVVANDRCNAQLGSGTVTNNMICAG-LAKGGKDTCQGDSGGPMVTRLCTVWIQAGITSWGYGCA 246

  Fly   236 RPNYPTVYCYVASFVDWIEETIA 258
            .||.|.||..|:.:..||...|:
Zfish   247 DPNSPGVYTRVSQYQSWISSKIS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 85/252 (34%)
Tryp_SPc 26..256 CDD:238113 86/254 (34%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 85/252 (34%)
Tryp_SPc 34..267 CDD:238113 86/254 (34%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.