DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and Prss53

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:231 Identity:60/231 - (25%)
Similarity:86/231 - (37%) Gaps:70/231 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CAGVIISEQALITSAQCLYGL-------------PEE--TKLVAVAGANTRNGTDGFIYPVANWT 106
            |.|.::||..::|:|.|..|.             |||  .|.:.:.||.|               
  Rat   365 CGGALVSEVVVLTAAHCFIGRQTLEEWSVGLGAGPEEWGLKQLILHGAYT--------------- 414

  Fly   107 HHPNYDPVTVDNDIGVLLLDTTLDLTLLGISSIGIRP-------ERPAVGRLATVAGW--GYREE 162
             ||.     ..:|:..|||...:.|      ..|:||       .|...|.    .||  |...|
  Rat   415 -HPE-----GGHDVAFLLLAQPVTL------GPGLRPLCLPYADHRLPDGE----HGWVLGLTRE 463

  Fly   163 WG---PSSYKLEQTEVPVVSSEQCTQIYGAGEVTERMICAGFV---VQGGSDACQGDTGGPLV-- 219
            .|   |.:     ..|.|:....|::.:.|...|...|..|.:   |.|....|:|.:|.|||  
  Rat   464 AGINHPHT-----VPVTVLGPMACSRQHAASGSTGVPILPGMICTTVVGEPPHCEGLSGAPLVHE 523

  Fly   220 IDGQ--LVGLVSWGRGCARPNYPTVYCYVASFVDWI 253
            |.|.  |.||.|:|..|.....|.|:..::::.||:
  Rat   524 IRGTWFLAGLHSFGDTCQGSAKPAVFAALSAYEDWV 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 59/229 (26%)
Tryp_SPc 26..256 CDD:238113 60/231 (26%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113
Tryp_SPc 341..561 CDD:238113 60/231 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343308
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.