DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and KLK14

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:280 Identity:100/280 - (35%)
Similarity:132/280 - (47%) Gaps:61/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLLAIGFSSVISI----SGQPEGRIINGTTVDIARHPYLVSL----RYRRDNESSYMHECAGVI 61
            |||.|:   .|::|    |.:.|.:||.|.|...:..|:..:|    |.|        ..|.|.:
Human     3 LLLTAL---QVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRR--------FLCGGAL 56

  Fly    62 ISEQALITSAQCLYGLPEETKLVAVAGANTR--NGTDGFIYPVANWTHHPNYDPVTVDNDIGVLL 124
            :|.|.:||:|.|  |.|  ...||:...|.|  ..|...:..|...| ||||:..|.|||:.:|.
Human    57 LSGQWVITAAHC--GRP--ILQVALGKHNLRRWEATQQVLRVVRQVT-HPNYNSRTHDNDLMLLQ 116

  Fly   125 LDTTLDLTLLGISSIGIRPERP--------AVGRLATVAGWG--------YREEWGPSSYKLEQT 173
            |...        :.|| |..||        :.|....|:|||        |     |:|  |:..
Human   117 LQQP--------ARIG-RAVRPIEVTQACASPGTSCRVSGWGTISSPIARY-----PAS--LQCV 165

  Fly   174 EVPVVSSEQCTQIYGAGEVTERMICAGFVVQGGSDACQGDTGGPLVIDGQLVGLVSWG-RGCARP 237
            .:.:...|.|.:.| ...:|..|:||| |.|||.|:||||:|||||..|||.|||||| ..||.|
Human   166 NINISPDEVCQKAY-PRTITPGMVCAG-VPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALP 228

  Fly   238 NYPTVYCYVASFVDWIEETI 257
            .||.||..:..:..|||||:
Human   229 GYPGVYTNLCKYRSWIEETM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 87/250 (35%)
Tryp_SPc 26..256 CDD:238113 90/252 (36%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 90/252 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.