DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and Tmprss9

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:278 Identity:89/278 - (32%)
Similarity:132/278 - (47%) Gaps:57/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PEG---RIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQC--LYGLPEET 81
            |.|   ||:.|:...:...|:.|||..||..     |.|..|:::|:.|:::|.|  :||.|  .
Mouse  1078 PPGALTRIVGGSAASLGEWPWQVSLWLRRRE-----HRCGAVLVAERWLLSAAHCFDIYGDP--M 1135

  Fly    82 KLVAVAGANTRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTLDLTLLGISSIGIR---- 142
            :..|..|....:.|:|.:..||....||.|:..|:|.|:.:|.|...:..:.|      :|    
Mouse  1136 QWAAFLGTPFLSSTEGQLERVARIYRHPFYNIYTLDYDVALLELAGPVRRSRL------VRPICL 1194

  Fly   143 --PERPAVGRLATVAGWGYREEWG-----------------------PS---SYKLEQTEVPVVS 179
              |.||..|....:.|||...|.|                       |:   :.:|::..|.|:|
Mouse  1195 PGPARPPDGARCVITGWGSLREGGIHACVRRSPGGVGDTPHLHLSPDPTGSMARQLQKAAVRVLS 1259

  Fly   180 SEQCTQIYGAGEVTERMICAGFVVQGGSDACQGDTGGPLVI---DGQ--LVGLVSWGRGCARPNY 239
            .:.|.:.|.. :::.||:|||| .|||.|:|.||.||||..   .||  |.|:.|||.||.||::
Mouse  1260 EQTCRRFYPV-QISSRMLCAGF-PQGGVDSCSGDAGGPLACREPSGQWVLTGVTSWGYGCGRPHF 1322

  Fly   240 PTVYCYVASFVDWIEETI 257
            |.||..||:.:.||.:.|
Mouse  1323 PGVYTRVAAVLGWIGQNI 1340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 84/266 (32%)
Tryp_SPc 26..256 CDD:238113 85/268 (32%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060
Tryp_SPc 455..684 CDD:214473
Tryp_SPc 756..984 CDD:214473
Tryp_SPc 1085..1336 CDD:238113 83/265 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.