DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and Sems

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:236 Identity:73/236 - (30%)
Similarity:114/236 - (48%) Gaps:25/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIING-TTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQCLYGLPEETKLVAVAG 88
            |:|.| .|.:.....|||::||..:      ..|.|.:|.|..::|:|.|.....|: :..:|.|
  Fly    43 RVIGGRVTTNAKLGGYLVAMRYFNN------FICGGTLIHELIVLTAAHCFEDRAEK-EAWSVDG 100

  Fly    89 ANTRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTL---DLTLLGISSIGIRPERPAVGR 150
            ..:|....|....|..:.....:..||::.|:.|:||:..:   ::..|.:.|..:.|     |:
  Fly   101 GISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPMVGKNIGTLSLCSTALTP-----GQ 160

  Fly   151 LATVAGWGYR--EEWGPSSYKLEQTEVPVVSSEQCTQIYGAG-EVTERMICAGFVVQGGSDACQG 212
            ...|:|||..  ::.|| .:.|....|||:....|.:.|... .:::.|.||.  |.|..|||..
  Fly   161 TMDVSGWGMTNPDDEGP-GHMLRTVSVPVIEKRICREAYRESVSISDSMFCAS--VLGKKDACTY 222

  Fly   213 DTGGPLVIDGQLVGLVSWGRGCARPNYPTVYC---YVASFV 250
            |:|||||.:.|:.|:||:|.|||...||.||.   ||..|:
  Fly   223 DSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDVHYVKPFI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 73/236 (31%)
Tryp_SPc 26..256 CDD:238113 72/235 (31%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 72/234 (31%)
Tryp_SPc 44..265 CDD:238113 72/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.