DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and CG32833

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:241 Identity:64/241 - (26%)
Similarity:111/241 - (46%) Gaps:30/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 INGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQCLYGLPEETKLVAVAGANT 91
            :.|..|:|...|::.|:..::      ..:|.|.|.....::|:.:|:.|...:...|.| |:.|
  Fly    39 LGGHPVNITTAPWIASISIKQ------KAKCDGAIYKLSHIVTAGKCVDGFLNKVIRVRV-GSTT 96

  Fly    92 RNGTDGFI-YPVANWTHHPNYDPVTVDNDIGVLLLDTTLDLTLLGISSIGIRPERPAVGRLATVA 155
            |  :||.| ..|.|.|.|..:...||.:::.:|.|...|:.:.. |..|.:..:.|:.|...|..
  Fly    97 R--SDGVIEVAVCNITVHEKFTGQTVFHNVAILKLCEPLEASKT-IQPIQLANQLPSNGAKVTAN 158

  Fly   156 GWGYREEWG--------PSSYKLEQTEVPVVSSEQCTQIYGAG-----EVTERMICAGFVVQGGS 207
            ||.....|.        ..:|||::.||.::...|||.::...     ..|:.:.|   ..:...
  Fly   159 GWPSFRWWAMYWKKCLDDEAYKLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFC---TEKFAK 220

  Fly   208 DACQGDTGGPLVIDGQLVGLVSWGRGCARPNYPTVYCYVASFVDWI 253
            :||....|.|:|.:|:|||:::.| ||:  .||.||..:..:.||:
  Fly   221 EACSLAMGSPVVHNGKLVGIITKG-GCS--EYPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 63/239 (26%)
Tryp_SPc 26..256 CDD:238113 64/241 (27%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 64/240 (27%)
Tryp_SPc 40..262 CDD:214473 62/237 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.