DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and gammaTry

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster


Alignment Length:249 Identity:88/249 - (35%)
Similarity:135/249 - (54%) Gaps:17/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AIGFSSVISISGQPEGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQC 73
            |:|.:....:..|.:|||:.|:...|:..|:.:||      :.|..|.|.|.|.|...::|:|.|
  Fly    14 ALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISL------QRSGSHSCGGSIYSSNVIVTAAHC 72

  Fly    74 LYGLPEETKLVAVAGANTRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTLDLTLLGISS 138
            |..:  ...::.:...::...:.|..:.|:::.:|..|:..|:.|||.::.::..|..:.. |.:
  Fly    73 LQSV--SASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSST-IKA 134

  Fly   139 IGIRPERPAVGRLATVAGWGYREEWGPSSY--KLEQTEVPVVSSEQC-TQIYGAG-EVTERMICA 199
            ||:....||.|..|:|:||| ...:|.||.  :|:...|.:||..|| :..||.| ::...||||
  Fly   135 IGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICA 198

  Fly   200 GFVVQGGSDACQGDTGGPLVIDGQLVGLVSWGRGCARPNYPTVYCYVASFVDWI 253
               ...|.||||||:|||||..|.|||:||||.|||..|||.||..||:...|:
  Fly   199 ---AASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 83/231 (36%)
Tryp_SPc 26..256 CDD:238113 83/232 (36%)
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 83/231 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.